SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_002459.2.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_002459.2.92137
Domain Number 1 Region: 173-307
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.7e-28
Family Toll/Interleukin receptor TIR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 20-135
Classification Level Classification E-value
Superfamily DEATH domain 3.24e-26
Family DEATH domain, DD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_002459.2.92137
Sequence length 309
Comment myeloid differentiation primary response protein MyD88 isoform 2 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MRPDRAEAPGPPAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADW
TALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP
SIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICY
CPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDY
LQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWT
RLAKALSLP
Download sequence
Identical sequences A0A0A0MS70
ENSP00000379625 ENSP00000379625 9606.ENSP00000379625 gi|197276654|ref|NP_002459.2| NP_002459.2.87134 NP_002459.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]