SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_002537.3.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_002537.3.92137
Domain Number 1 Region: 207-287
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000606
Family DEATH domain, DD 0.027
Further Details:      
 
Domain Number 2 Region: 32-83
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000173
Family TNF receptor-like 0.0063
Further Details:      
 
Domain Number 3 Region: 103-160
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000104
Family TNF receptor-like 0.0023
Further Details:      
 
Domain Number 4 Region: 293-371
Classification Level Classification E-value
Superfamily DEATH domain 0.00000132
Family DEATH domain, DD 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_002537.3.92137
Sequence length 401
Comment tumor necrosis factor receptor superfamily member 11B precursor [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKT
VCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLK
HRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNAT
HDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERI
KRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLME
SLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKT
VTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Download sequence
Identical sequences O00300
NP_002537.3.87134 NP_002537.3.92137 gi|148743793|ref|NP_002537.3| ENSP00000297350 9606.ENSP00000297350 GO.43425 ENSP00000297350 ENSP00000297350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]