SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_002937.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_002937.1.87134
Domain Number 1 Region: 45-171
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.13e-43
Family Single strand DNA-binding domain, SSB 0.000000351
Further Details:      
 
Domain Number 2 Region: 203-269
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.45e-20
Family C-terminal domain of RPA32 0.0000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_002937.1.87134
Sequence length 270
Comment replication protein A 32 kDa subunit isoform 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV
DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGR
APISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVS
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
Download sequence
Identical sequences P15927
9606.ENSP00000363021 ENSP00000363021 gi|4506585|ref|NP_002937.1| ENSP00000363021 NP_002937.1.87134 NP_002937.1.92137 2pi2A ENSPANP00000005908 2pi2_A 2pi2_B 2pi2_C 2pi2_D 2z6k_A 2z6k_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]