SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_003136.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_003136.1.87134
Domain Number - Region: 37-105
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00209
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_003136.1.87134
Sequence length 183
Comment translocon-associated protein subunit beta precursor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELS
DDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPV
VIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKT
KKN
Download sequence
Identical sequences A0A2I3HPW5 A0A2J8K514 A0A2J8VGN8 P43308
NP_003136.1.87134 NP_003136.1.92137 XP_004089904.1.23891 XP_004089905.1.23891 ENSPTRP00000002439 ENSP00000295702 ENSP00000434306 ENSP00000295702 ENSP00000434306 ENSP00000295702 9606.ENSP00000295702 ENSNLEP00000014951 HR181 ENSNLEP00000014951 ENSPTRP00000002439 gi|4507239|ref|NP_003136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]