SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_003661.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_003661.1.87134
Domain Number 1 Region: 49-124
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000471
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 139-181
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000144
Family Hairy Orange domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_003661.1.87134
Sequence length 412
Comment class E basic helix-loop-helix protein 40 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLI
EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIA
LQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVS
ELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTD
TDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGH
FTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAA
ALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD
Download sequence
Identical sequences G3RIG8 H2R8H1 O14503 Q6IB83
ENSP00000256495 ENSGGOP00000015470 9606.ENSP00000256495 ENSPTRP00000051613 gi|4503299|ref|NP_003661.1| ENSPTRP00000051613 O14503 ENSGGOP00000015470 NP_003661.1.87134 NP_003661.1.92137 XP_004033573.1.27298 XP_516248.3.37143 ENSP00000256495 ENSP00000256495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]