SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_003845.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_003845.2.87134
Domain Number 1 Region: 373-537
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.28e-23
Family Toll/Interleukin receptor TIR domain 0.0041
Further Details:      
 
Domain Number 2 Region: 27-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000734
Family I set domains 0.0079
Further Details:      
 
Domain Number 3 Region: 134-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000934
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 229-328
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000135
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_003845.2.87134
Sequence length 575
Comment interleukin-1 receptor-like 2 precursor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNS
SKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWCDT
SIGGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVLGPIKWYKDCNEIKGERFTVLETRL
LVSNVSAEDRGNYACQAILTHSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNHSIEVQ
LGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNI
TFLEVKMEDYGLPFMCHAGVSTAYIILQLPAPDFRAYLIGGLIALVAVAVSVVYIYNIFK
IDIVLWYRSAFHSTETIVDGKLYDAYVLYPKPHKESQRHAVDALVLNILPEVLERQCGYK
LFIFGRDEFPGQAVANVIDENVKLCRRLIVIVVPESLGFGLLKNLSEEQIAVYSALIQDG
MKVILIELEKIEDYTVMPESIQYIKQKHGAIRWHGDFTEQSQCMKTKFWKTVRYHMPPRR
CRPFPPVQLLQHTPCYRTAGPELGSRRKKCTLTTG
Download sequence
Identical sequences Q9HB29
ENSP00000264257 ENSP00000264257 ENSP00000264257 ENSP00000442184 NP_003845.2.87134 NP_003845.2.92137 XP_005264093.1.92137 9606.ENSP00000264257 gi|28416902|ref|NP_003845.2| NYSGRC-IgSF-ILRL2_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]