SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_005161.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_005161.1.92137
Domain Number 1 Region: 54-130
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.5e-18
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_005161.1.92137
Sequence length 193
Comment achaete-scute homolog 2 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERER
NRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL
RPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAE
RELLDFSSWLGGY
Download sequence
Identical sequences Q99929
ENSP00000332293 ENSP00000332293 NP_005161.1.87134 NP_005161.1.92137 gi|4885665|ref|NP_005161.1| HR4510 9606.ENSP00000332293 ENSP00000332293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]