SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_005732.2.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_005732.2.92137
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-38
Family SCAN domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 471-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 583-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 629-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 5 Region: 433-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 512-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000148
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 211-265
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000051
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 
Domain Number 8 Region: 374-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000121
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_005732.2.92137
Sequence length 683
Comment zinc finger protein 263 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MASGPGSQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRQQVTNHGRGTEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQ
RDPQAVKERALSAPWLSLFPPEGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRA
LSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPSVQSCKEGLSPRGPAPGEEKF
ENLEGVPSVCSENIHPQVLLPDQARGEVPWSPELGRPHDRSQGDWAPPPEGGMEQALAGA
SSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDCTEIFGGNPR
FLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLHRH
QRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERTH
ERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTGE
KPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYK
CSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences O14978
ENSP00000219069 NP_005732.2.87134 NP_005732.2.92137 ENSP00000219069 9606.ENSP00000219069 ENSP00000219069 gi|31543980|ref|NP_005732.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]