SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_006462.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_006462.1.92137
Domain Number 1 Region: 25-164
Classification Level Classification E-value
Superfamily EF-hand 4.15e-42
Family Calmodulin-like 0.0000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_006462.1.92137
Sequence length 171
Comment myosin regulatory light chain 12A isoform 1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASL
GKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQED
YLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Download sequence
Identical sequences A0A2I2YXF4 A0A2J8XGQ0 H2QE78 P19105 Q5RC34
ENSP00000217652 ENSP00000441231 ENSP00000462171 ENSP00000463614 ENSGGOP00000011144 9598.ENSPTRP00000016740 9606.ENSP00000217652 NP_001289976.1.87134 NP_001289976.1.92137 NP_001289977.1.87134 NP_001289977.1.92137 NP_006462.1.87134 NP_006462.1.92137 XP_003315879.1.37143 XP_008969399.1.60992 XP_009250543.1.23681 XP_009250544.1.23681 XP_009250545.1.23681 XP_018869420.1.27298 ENSPPYP00000010137 ENSPTRP00000016740 ENSP00000217652 ENSP00000441231 ENSP00000462171 ENSP00000463614 gi|5453740|ref|NP_006462.1| ENSPTRP00000016740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]