SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_008982.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_008982.1.92137
Domain Number 1 Region: 532-648
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.96e-30
Family UBX domain 0.0000166
Further Details:      
 
Domain Number 2 Region: 333-485
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000183
Family UAS domain 0.086
Further Details:      
 
Domain Number 3 Region: 88-176
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000137
Family Ubiquitin-related 0.024
Further Details:      
 
Domain Number 4 Region: 189-257
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000691
Family Ubiquitin-related 0.043
Further Details:      
 
Weak hits

Sequence:  NP_008982.1.92137
Domain Number - Region: 6-42
Classification Level Classification E-value
Superfamily UBA-like 0.00561
Family TAP-C domain-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_008982.1.92137
Sequence length 650
Comment FAS-associated factor 1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSEYGGET
IPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDTC
TVGEIKQILENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSS
SHAGALQESLNQNFMLIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGW
PTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITDVHMVSDSDGDDFEDAT
EFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAA
FQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSN
RARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRL
MAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLE
QIRKEQEEEREAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVF
DFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Download sequence
Identical sequences Q9UNN5
9606.ENSP00000379457 ENSP00000379457 ENSP00000360843 GO.34966 GO.55848 HR3518 ENSP00000360843 ENSP00000379457 gi|5901948|ref|NP_008982.1| NP_008982.1.87134 NP_008982.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]