SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_009062.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_009062.2.87134
Domain Number 1 Region: 42-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.66e-34
Family SCAN domain 0.000079
Further Details:      
 
Domain Number 2 Region: 402-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 443-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-20
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 4 Region: 360-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 233-278
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-17
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_009062.2.87134
Sequence length 510
Comment zinc finger protein 75D isoform 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MAMRELNADSCSSPQMGAMWETSGSVKENSSQSKKYSTKIENLGPESACRHFWSFRYHEA
TGPLETISQLQKLCHQWLRPEIHSKEQILEMLVLEQFLSILPKETQNWVQKHHPQNVKQA
LVLVEFLQREPDGTKNEVTAHELGKEAVLLGGTAVAPGFKWKPAEPQPMGVFQKEYWNTY
RVLQEQLGWNTHKETQPVYERAVHDQQMLALSEQKRIKHWKMASKLILPESLSLLTFEDV
AVYFSEEEWQLLNPLEKTLYNDVMQDIYETVISLGLKLKNDTGNDHPISVSTSEIQTSGC
EVSKKTRMKIAQKTMGRENPGDTHSVQKWHRAFPRKKRKKPATCKQELPKLMDLHGKGPT
GEKPFKCQECGKSFRVSSDLIKHHRIHTGEKPYKCQQCDRRFRWSSDLNKHFMTHQGIKP
YRCSWCGKSFSHNTNLHTHQRIHTGEKPFKCDECGKRFIQNSHLIKHQRTHTGEQPYTCS
LCKRNFSRRSSLLRHQKLHRRREACLVSPN
Download sequence
Identical sequences P51815
ENSP00000359800 ENSP00000359802 ENSP00000471278 ENSP00000359802 gi|41152070|ref|NP_009062.2| 9606.ENSP00000359802 NP_009062.2.87134 NP_009062.2.92137 XP_005262526.1.92137 XP_011529693.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]