SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_009118.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_009118.1.92137
Domain Number 1 Region: 9-110
Classification Level Classification E-value
Superfamily PDB 8.78e-28
Family PDB 0.008
Further Details:      
 
Domain Number 2 Region: 168-199
Classification Level Classification E-value
Superfamily WW domain 0.000000000412
Family WW domain 0.075
Further Details:      
 
Domain Number 3 Region: 127-158
Classification Level Classification E-value
Superfamily WW domain 0.00000000771
Family WW domain 0.0013
Further Details:      
 
Domain Number 4 Region: 9-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000308
Family HkH motif-containing C2H2 finger 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_009118.1.92137
Sequence length 376
Comment WW domain-binding protein 4 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEK
ASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRK
KDPSKGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTY
YYNTETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQEAEEGGV
STETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEI
KQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMADGVAPVFKKRR
TENGKSRNLRQRGDDQ
Download sequence
Identical sequences O75554
9606.ENSP00000368801 ENSP00000368801 ENSP00000368801 ENSP00000368801 gi|6005948|ref|NP_009118.1| NP_009118.1.87134 NP_009118.1.92137 5o9z_Q

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]