SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_009569.1.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_009569.1.97178
Domain Number - Region: 56-117
Classification Level Classification E-value
Superfamily TPR-like 0.0417
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_009569.1.97178
Sequence length 129
Comment hypothetical protein YBR013C [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MIYPLFRICILGAFLLGSYACLENSTQKGIEGVTLSHNSVQINNTLAKSAPFCESDALSM
NYSTENMLSNNACDYTKNSSYPYIITIITKAFDNALENSLNLQANRKLYHRVGTCIQNIF
YQLLLTVNY
Download sequence
Identical sequences P38215
4932.YBR013C NP_009569.1.97178 YBR013C YBR013C YBR013C YBR013C YTYst418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]