SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_010285.1.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_010285.1.97178
Domain Number 1 Region: 61-200
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-50
Family Ran-binding domain 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_010285.1.97178
Sequence length 201
Comment Ran GTPase-binding protein YRB1 [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MSSEDKKPVVDKKEEAAPKPPSSAVFSMFGGKKAEKPETKKDEEDTKEETKKEGDDAPES
PDIHFEPVVHLEKVDVKTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTN
KVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGS
KENADKFKEEFEKAQEINKKA
Download sequence
Identical sequences A0A250W947 A6ZXW7 B3LGQ7 B5VFR2 C7GXY9 E7KAP0 E7NGM6 E7Q210 E7QCN2 G2WCF5 N1P601 P41920
YDR002W SCRT_00506 YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W tr|A6ZXW7|A6ZXW7_YEAS7 YDR002W NP_010285.1.97178 4932.YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W NYSGXRC-P033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]