SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_011725.3.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_011725.3.97178
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.14e-35
Family SCOPe 0.0000976
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_011725.3.97178
Sequence length 104
Comment thioredoxin TRX2 [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDE
VSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV
Download sequence
Identical sequences A0A0L8VPU3 A6ZUM0 B3LI27 C7GRP2 C8Z9A2 E7KD15 E7LUY2 E7NI51 E7Q4B3 E7QF91 H0GGV3 N1P638 P22803
tr|A6ZUM0|A6ZUM0_YEAS7 YGR209C NP_011725.3.97178 YGR209C YGR209C YGR209C YGR209C 000162817|e2fa4A1|2485.1.1.40|A:8-111 000311154|e2fa4B1|2485.1.1.40|B:8-111 000316679|e2hsyA1|2485.1.1.40|A:1-104 cath|current|2hsyA00/1-104 d2fa4a_ d2fa4b_ d2hsya_ YGR209C YGR209C 2hsy_A YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C 4932.YGR209C YGR209C YGR209C YGR209C SCRT_00812 YGR209C YGR209C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]