SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_012255.3.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_012255.3.97178
Domain Number 1 Region: 61-210
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.49e-32
Family Glutathione peroxidase-like 0.000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_012255.3.97178
Sequence length 215
Comment thioredoxin peroxidase DOT5 [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MGEALRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANRSSDV
NELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQE
LKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIF
VDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKEE
Download sequence
Identical sequences N1P967 P40553
NP_012255.3.97178 XP_015332418.1.40921 4932.YIL010W YIL010W YIL010W YIL010W YIL010W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]