SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_012269.1.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_012269.1.97178
Domain Number 1 Region: 5-100
Classification Level Classification E-value
Superfamily Chaperone J-domain 8.9e-28
Family Chaperone J-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_012269.1.97178
Sequence length 432
Comment Djp1p [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MVVDTEYYDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGD
DDLRAKYDKYGRKEAIPQGGFEDAAEQFSVIFGGDAFASYIGELMLLKNLQKTEELNAED
EAEKEKENVETMEESPADGKTNGTTNAVDAALGNTNEKDDKNKARTTSGNLTVHDGNKKN
EQVGAEAKKKKTKLEQFEEEQEVEKQKRVDQLSKTLIERLSILTESVYDDACKDSFKKKF
EEEANLLKMESFGLDILHTIGDVYYEKAEIFLASQNLFGMGGIFHSMKAKGGVFMDTLRT
VSAAIDAQNTMKELEKMKEASTNNEPLFDKDGNEQIKPTTEELAQQEQLLMGKVLSAAWH
GSKYEITSTLRGVCKKVLEDDSVSKKTLIRRAEAMKLLGEVFKKTFRTKVEQEEAQIFEE
LVAEATKKKRHT
Download sequence
Identical sequences B3LTK5 C7GJG8 N1P1R8 P40564
SCRT_05176 YIR004W YIR004W YIR004W YIR004W YIR004W YIR004W 4932.YIR004W NP_012269.1.97178 YIR004W YIR004W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]