SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_012899.3.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_012899.3.97178
Domain Number 1 Region: 2-159
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.2e-53
Family Glutathione peroxidase-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_012899.3.97178
Sequence length 167
Comment glutathione peroxidase GPX1 [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MQEFYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQYKELEYLYEKYKSHGLVIV
AFPCGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGI
KMIKWNFEKFVVDRNGKVVKRFSCMTRPLELCPIIEELLNQPPEEQI
Download sequence
Identical sequences A0A250WJJ4 A6ZZT7 C8ZCE1 E7QHB8 G2WI03 H0GJA3 N1P0C0 P36014
YKL026C YKL026C YKL026C YKL026C YKL026C YKL026C YKL026C YKL026C 4932.YKL026C YKL026C NP_012899.3.97178 tr|A6ZZT7|A6ZZT7_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]