SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_012952.3.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_012952.3.97178
Domain Number 1 Region: 343-401
Classification Level Classification E-value
Superfamily TPR-like 0.00000526
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Weak hits

Sequence:  NP_012952.3.97178
Domain Number - Region: 253-344
Classification Level Classification E-value
Superfamily ARM repeat 0.0108
Family BC3264-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_012952.3.97178
Sequence length 765
Comment Bch2p [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MSFLWGSTKSKKGKNKKAAGSLPSGVVPQQRVKPTRKNVPIDYPRTLEKVHGESLIFRTS
LLSELVSTGKSGIGPPDLIHCTELDKFHDEKIGEFFYITGIDASSVSMPIAFLKLIKWND
GKKLKSASLKNDDITTYCTFNIFQKLDIRLRYESEDVYQVNIVDCLNGNNEIPLSDLIWE
ETFVSCCIRSVIINSDFERKIPGLVELPFVFENRCASDYKRVIDSLCKFLPRFLECGWDS
TKSVYATILNNYLTESLLVFLSITPEFITDYAIQVLDNLMTNDPSNSRYYAIVIISIMER
SNDRDVEMIKRIHEILDLLLPVLYGLPSDEPYISDLINCITDVLSIQARFLLNNNDYELS
LSISTLATNLSSDNFESWYLLSKGYIFSQQYDKALLSINSMPCLAEYDIVKQAQINAFKF
YMNYYKAPLCHSREHCTMTSHELNHLMNIMHYENELELKTIIFGRTVMPNESKYGCIEEI
WNKSCLELGPICGPQSDNLINFVSQQEVNTVGDMLLLKRSKETRQESWFIKQVRLLLMEL
VARIGWNALLQLRSDVFVMESKFKMIESSDKLSTELRQKRLCQRWFDAMFLDVYEDLSIS
TSSQENKATAKYSGLEWELLGLTLLRVSDLPDAVACLRTSILARFDPISCHHLLNFYLTM
DFNDEFMRRFDVDIILDLLVKLISFRIRFYDRFQIFSLQVLRKLEGQLGSEIIKNKIINS
PYGQAGITSVIDYMLECLSKNRNEACLAYERPLPDLPSTIKPLAD
Download sequence
Identical sequences A0A0L8VML3 N1P0H1 P36122
YKR027W YKR027W YKR027W 4932.YKR027W NP_012952.3.97178 YKR027W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]