SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_013301.1.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_013301.1.97178
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Prefoldin 1.07e-27
Family Prefoldin 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_013301.1.97178
Sequence length 114
Comment tubulin-binding prefolding complex subunit YKE2 [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE
QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR
Download sequence
Identical sequences C7GIT1 N1NYD5 P52553
4932.YLR200W APC7612 YLR200W YLR200W YLR200W YLR200W NP_013301.1.97178 YLR200W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]