SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_013693.1.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_013693.1.97178
Domain Number - Region: 77-148
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000148
Family PDI-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_013693.1.97178
Sequence length 332
Comment dolichyl-diphosphooligosaccharide--protein glycotransferase [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MKWCSTYIIIWLAIIFHKFQKSTATASHNIDDILQLKDDTGVITVTADNYPLLSRGVPGY
FNILYITMRGTNSNGMSCQLCHDFEKTYHAVADVIRSQAPQSLNLFFTVDVNEVPQLVKD
LKLQNVPHLVVYPPAESNKQSQFEWKTSPFYQYSLVPENAENTLQFGDFLAKILNISITV
PQAFNVQEFVYYFVACMVVFIFIKKVILPKVTNKWKLFSMILSLGILLPSITGYKFVEMN
AIPFIARDAKNRIMYFSGGSGWQFGIEIFSVSLMYIVMSALSVLLIYVPKISCVSEKMRG
LLSSFLACVLFYFFSYFISCYLIKNPGYPIVF
Download sequence
Identical sequences A0A250WF74 G2WK33 N1NY44 Q03723
YML019W 4932.YML019W 2223S YML019W NP_013693.1.97178 YML019W YML019W YML019W YML019W YML019W YML019W YML019W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]