SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_014670.1.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_014670.1.97178
Domain Number 1 Region: 261-384
Classification Level Classification E-value
Superfamily TPR-like 3.79e-43
Family Tetratricopeptide repeat (TPR) 0.0000722
Further Details:      
 
Domain Number 2 Region: 5-118
Classification Level Classification E-value
Superfamily TPR-like 2.61e-38
Family Tetratricopeptide repeat (TPR) 0.00058
Further Details:      
 
Domain Number 3 Region: 394-496
Classification Level Classification E-value
Superfamily TPR-like 2.89e-31
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 
Weak hits

Sequence:  NP_014670.1.97178
Domain Number - Region: 540-577
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0051
Family XPC-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_014670.1.97178
Sequence length 589
Comment Hsp90 cochaperone STI1 [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MSLTADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDAL
NDANECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASNKAAKEGLDQVHRT
QQARQAQPDLGLTQLFADPNLIENLKKNPKTSEMMKDPQLVAKLIGYKQNPQAIGQDLFT
DPRLMTIMATLMGVDLNMDDINQSNSMPKEPETSKSTEQKKDAEPQSDSTTSKENSSKAP
QKEESKESEPMEVDEDDSKIEADKEKAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNN
RAAAEYEKGEYETAISTLNDAVEQGREMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQ
KSLTEHRTADILTKLRNAEKELKKAEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYT
EMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEY
ASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRFQPGTSNETPEETYQRAMKDPEV
AAIMQDPVMQSILQQAQQNPAALQEHMKNPEVFKKIQTLIAAGIIRTGR
Download sequence
Identical sequences A0A250WAN1 G2WMQ8 P15705
YOR027W YOR027W YOR027W YOR027W YOR027W YOR027W YOR027W NP_014670.1.97178 4932.YOR027W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]