SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_014676.1.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_014676.1.97178
Domain Number 1 Region: 3-227
Classification Level Classification E-value
Superfamily PIN domain-like 8.83e-62
Family 5' to 3' exonuclease catalytic domain 0.00077
Further Details:      
 
Domain Number 2 Region: 212-311
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 1.21e-21
Family 5' to 3' exonuclease, C-terminal subdomain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_014676.1.97178
Sequence length 702
Comment Rad2 family nuclease EXO1 [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGKPTDKYLQFFI
KRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENKAIAERLWACGEKKNAMDYFQ
KCVDITPEMAKCIICYCKLNGIRYIVAPFEADSQMVYLEQKNIVQGIISEDSDLLVFGCR
RLITKLNDYGECLEICRDNFIKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITA
MKLVRRFNTIERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEIP
LYLKDTESKRKRLYACIGFVIHRETQKKQIVHFDDDIDHHLHLKIAQGDLNPYDFHQPLA
NREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFFQKMTKLDHNPKVANNIHSLRQAEDK
LTMAIKRRKLSNANVVQETLKDTRSKFFNKPSMTVVENFKEKGDSIQDFKEDTNSQSLEE
PVSESQLSTQIPSSFITTNLEDDDNLSEEVSEVVSDIEEDRKNSEGKTIGNEIYNTDDDG
DGDTSEDYSETAESRVPTSSTTSFPGSSQRSISGCTKVLQKFRYSSSFSGVNANRQPLFP
RHVNQKSRGMVYVNQNRDDDCDDNDGKNQITQRPSLRKSLIGARSQRIVIDMKSVDERKS
FNSSPILHEESKKRDIETTKSSQARPAVRSISLLSQFVYKGK
Download sequence
Identical sequences P39875
YOR033C YOR033C YOR033C 4932.YOR033C YOR033C YOR033C NP_014676.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]