SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_014694.1.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_014694.1.97178
Domain Number - Region: 273-311,338-390
Classification Level Classification E-value
Superfamily TPR-like 0.0569
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_014694.1.97178
Sequence length 412
Comment Ett1p [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MAKRPLGLGKQSREKKRKVESVEKKSDEPSRESTPVRSQMSVELDDDADLDDELAQLKGL
WSKYFHSDRDDEYVLNGIVHECDRLLRLSEEDKEIKKTLNDIFHGIYALALSELTIFKAG
DEEATEEKRKKDVSSFFESAIERVELGLSHFPESQFLKLVLAKIIFQRIPLEYISNLHLK
SKDKKLDLVGQLEHGKKHFSIYENDTEFTFEILQMVNDLLDIVENFGREQSIQEGIDSDN
EEEEELIDIELEPEHPVYPLQQSLEANYEWLRNHFDKLLDNTNTDVKIYASIANTLGELY
LKKAEEPSKVFLSLQYDDGGSEKVSDKEAKNAQETALKHTKKALEYLEKAKLEDDPDTWV
QVAEAYIDLGNLLDNESAEQEEAYKTAEEILGKANKASHGKFQDVLDNFLQG
Download sequence
Identical sequences C7GLH8 N1P300 Q08421
YOR051C 4932.YOR051C YOR051C YOR051C YOR051C NP_014694.1.97178 YOR051C YOR051C YOR051C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]