SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_015169.1.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_015169.1.97178
Domain Number - Region: 162-267
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0917
Family Thioltransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_015169.1.97178
Sequence length 284
Comment pheromone-regulated protein PRM4 [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MIADSSVLKKHTAIKRSTRIISLTLVLLGVFSFLLLTWNDSLEFYNSADPSENKKNSEEE
SEKKFVYKLPNLLKTADSFLSNENELNFQKVKEEISNIQSEVEVDIPEPSSKATSKFSSR
SFQTDNVVTATTTTTLNPRSSSLALQKNCDHKKFDPRTDFLDIIRTSPAVLFIKSSQADS
IFLKNLLQREFEISPELATVDLEKHSHGYELEKYIKQNKLNIDTSAALESIQSPYLFLNG
ISVINRGMVRDIIEPHSKGLLLPLLKSEARGNLLVEKKDIPSNS
Download sequence
Identical sequences N1P1F1 Q12498
YPL156C 4932.YPL156C YPL156C YPL156C YPL156C NP_015169.1.97178 YPL156C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]