SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_015314.1.97178 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_015314.1.97178
Domain Number - Region: 40-81
Classification Level Classification E-value
Superfamily Histone-fold 0.0178
Family TBP-associated factors, TAFs 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_015314.1.97178
Sequence length 353
Comment Taf3p [Saccharomyces cerevisiae S288C]; AA=GCF_000146045.2; RF=reference genome; TAX=559292; STAX=4932; NAME=Saccharomyces cerevisiae S288C; strain=S288c; AL=Complete Genome; RT=Major
Sequence
MTTNNDFYFALLRISILQLLKAQGFDRARPSLVDVMTDLYAKFLSLLASEVSSIAQARCD
QDDTIALQDITLALENLGIVKPTNVLDVYDENSELSSSRGMEKFKDWCIYSTQLTDARIT
ALPTVELLQSEEKESDPLSAIPDYLNQLLQNKGAKQKLETKNRKTELIEDLINNNGLDDW
IKLVIARQRINMIERASKKESQNVPALPHIAGYKSSILSRHHHTTITNEDRMPSAMTPRD
EDALTEIQENPFVTSKLPIMRKENRLENITLSFEDEELESLGEVEGPNQKSQENNNEESF
KENNKSLTESPHGDDRDISMFQFDSNVDTKWAEQEDMDSTFQRRTSLDYGGYF
Download sequence
Identical sequences N1NXD9 Q12297
YPL011C NP_015314.1.97178 YPL011C 4932.YPL011C YPL011C YPL011C Pf-sce:YPL011C YPL011C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]