SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_031402.3.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_031402.3.92730
Domain Number 1 Region: 970-1285
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.71e-91
Family Complement components 0.0000153
Further Details:      
 
Domain Number 2 Region: 1359-1488
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.44e-41
Family Alpha-macroglobulin receptor domain 0.00000041
Further Details:      
 
Domain Number 3 Region: 798-918
Classification Level Classification E-value
Superfamily E set domains 6.58e-32
Family SVA-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_031402.3.92730
Sequence length 1495
Comment pregnancy zone protein precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MRRNQLPTPAFLLLFLLLPRDATTATAKPQYVVLVPSEVYSGVPEKACVSLNHVNETVML
SLTLEYAMQQTKLLTDQAVDKDSFYCSPFTISGSPLPYTFITVEIKGPTQRFIKKKSIQI
IKAESPVFVQTDKPIYKPGQIVKFRVVSVDISFRPLNETFPVVYIETPKRNRIFQWQNIH
LAGGLHQLSFPLSVEPALGIYKVVVQKDSGKKIEHSFEVKEYVLPKFEVIIKMQKTMAFL
EEELPITACGVYTYGKPVPGLVTLRVCRKYSRYRSTCHNQNSMSICEEFSQQADDKGCFR
QVVKTKVFQLRQKGHDMKIEVEAKIKEEGTGIELTGIGSCEIANALSKLKFTKVNTNYRP
GLPFSGQVLLVDEKGKPIPNKNITSVVSPLGYLSIFTTDEHGLANISIDTSNFTAPFLRV
VVTYKQNHVCYDNWWLDEFHTQADHSATLVFSPSQSYIQLELVFGTLACGQTQEIRIHYL
LNEDIMKNEKDLTFYYLIKARGSIFNLGSHVLSLEQGNMKGVFSLPIQVEPGMAPEAQLL
IYAILPNEELVADAQNFEIEKCFANKVNLSFPSAQSLPASDTHLKVKAAPLSLCALTAVD
QSVLLLKPEAKLSPQSIYNLLPGKTVQGAFFGVPVYKDHENCISGEDITHNGIVYTPKHS
LGDNDAHSIFQSVGINIFTNSKIHKPRFCQEFQHYPAMGGVAPQALAVAASGPGSSFRAM
GVPMMGLDYSDEINQVVEVRETVRKYFPETWIWDLVPLDVSGDGELAVKVPDTITEWKAS
AFCLSGTTGLGLSSTISLQAFQPFFLELTLPYSVVRGEAFTLKATVLNYMSHCIQIRVDL
EISPDFLAVPVGGHENSHCICGNERKTVSWAVTPKSLGEVNFTATAEALQSPELCGNKLT
EVPALVHKDTVVKSVIVEPEGIEKEQTYNTLLCPQDTELQDNWSLELPPNVVEGSARATH
SVLGDILGSAMQNLQNLLQMPYGCGEQNMVLFVPNIYVLNYLNETQQLTEAIKSKAINYL
ISGYQRQLNYQHSDGSYSTFGNHGGGNTPGNTWLTAFVLKAFAQAQSHIFIEKTHITNAF
NWLSMKQKENGCFQQSGYLLNNAMKGGVDDEVTLSAYITIALLEMPLPVTHSAVRNALFC
LETAWASISQSQESHVYTKALLAYAFALAGNKAKRSELLESLNKDAVKEEDSLHWQRPGD
VQKVKALSFYQPRAPSAEVEMTAYVLLAYLTSESSRPTRDLSSSDLSTASKIVKWISKQQ
NSHGGFSSTQDTVVALQALSKYGAATFTRSQKEVLVTIESSGTFSKTFHVNSGNRLLLQE
VRLPDLPGNYVTKGSGSGCVYLQTSLKYNILPVADGKAPFALQVNTLPLNFDKAGDHRTF
QIRINVSYTGERPSSNMVIVDVKMVSGFIPMKPSVKKLQDQPNIQRTEVNTNHVLIYIEK
LTNQTLGFSFAVEQDIPVKNLKPAPIKVYDYYETDEFTVEEYSAPFSDGSEQGNA
Download sequence
Identical sequences Q61838
NP_031402.3.92730 ENSMUSP00000107760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]