SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_031460.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_031460.1.92730
Domain Number 1 Region: 147-460
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-99
Family Protein kinases, catalytic subunit 0.0000000000167
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 7.61e-25
Family Pleckstrin-homology domain (PH domain) 0.000000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_031460.1.92730
Sequence length 481
Comment RAC-beta serine/threonine-protein kinase [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDAM
DYKCGSPSDSSTSEMMEVAVNKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLDPLELDQRTHFPQFSYSASIR
E
Download sequence
Identical sequences Q3TY95 Q60823
10090.ENSMUSP00000103981 ENSMUSP00000083081 ENSMUSP00000052103 ENSMUSP00000103980 ENSMUSP00000103981 ENSMUSP00000132141 NP_001103678.1.92730 NP_031460.1.92730 XP_006539540.1.92730 XP_006539541.1.92730 XP_006539543.1.92730 XP_006539544.1.92730 XP_011248720.1.92730 ENSMUSP00000052103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]