SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_031632.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_031632.2.92730
Domain Number 1 Region: 3-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.23e-98
Family Carbonic anhydrase 0.0000000000773
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_031632.2.92730
Sequence length 260
Comment carbonic anhydrase 3 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MAKEWGYASHNGPDHWHELYPIAKGDNQSPIELHTKDIKHDPSLQPWSASYDPGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLSGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFGEALKQPDGIAVVGIFLKIGREKGEFQILLDALDKIKTKGKEAPFTHFDP
SCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLFSSAENEPPVPL
VGNWRPPQPVKGRVVRASFK
Download sequence
Identical sequences P16015
ENSMUSP00000029076 ENSMUSP00000029076 ENSMUSP00000029076 NP_031632.2.92730 10090.ENSMUSP00000029076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]