SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_032199.3.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_032199.3.92730
Domain Number 1 Region: 487-772
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-63
Family Nuclear receptor ligand-binding domain 0.0000000019
Further Details:      
 
Domain Number 2 Region: 434-516
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.4e-27
Family Nuclear receptor 0.0000126
Further Details:      
 
Weak hits

Sequence:  NP_032199.3.92730
Domain Number - Region: 74-109
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00392
Family beta-sandwich domain of Sec23/24 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_032199.3.92730
Sequence length 792
Comment glucocorticoid receptor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSASSPSVAAASQADSKQQ
RILLDFSKGSASNAQQQQQQQQQQQQQQQQQPQPDLSKAVSLSMGLYMGETETKVMGNDL
GYPQQGQLGLSSGETDFRLLEESIANLNRSTSRPENPKSSTPAAGCATPTEKEFPQTHSD
PSSEQQNRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPWRSDLLIDEN
LLSPLAGEDDPFLLEGDVNEDCKPLILPDTKPKIQDTGDTILSSPSSVALPQVKTEKDDF
IELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQ
QQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNFAGRSVFSNGYSSPGMRPDVS
SPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCI
IDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQDTSENANKTIVPAAL
PQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGFR
NLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLIINEQRMTLPCMYDQCKH
MLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKRE
GNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSIEFPEMLAEIITNQIPKYS
NGNIKKLLFHQK
Download sequence
Identical sequences E9PUR6
ENSMUSP00000025300 ENSMUSP00000111229 ENSMUSP00000111233 NP_032199.3.92730 XP_006525729.1.92730 XP_017173324.1.92730 XP_017173325.1.92730 XP_017173326.1.92730 XP_017173327.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]