SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_032508.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_032508.2.92730
Domain Number 1 Region: 821-871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000162
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 2 Region: 383-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 3 Region: 869-917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 915-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000022
Family Laminin-type module 0.0041
Further Details:      
 
Domain Number 5 Region: 319-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 6 Region: 1024-1075
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family Laminin-type module 0.003
Further Details:      
 
Domain Number 7 Region: 976-1026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.084
Further Details:      
 
Domain Number 8 Region: 506-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 9 Region: 558-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000226
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1132-1174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 11 Region: 469-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 12 Region: 1180-1227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 13 Region: 1076-1129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000019
Family Laminin-type module 0.003
Further Details:      
 
Weak hits

Sequence:  NP_032508.2.92730
Domain Number - Region: 1617-1825
Classification Level Classification E-value
Superfamily Tropomyosin 0.000255
Family Tropomyosin 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_032508.2.92730
Sequence length 1834
Comment laminin subunit beta-1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MEGPLSSLPTFAFSPRYLSRKEDPKKRQAACLLRPPSRAASPRLRGLDMGLLQVFAFGVL
ALWGTRVCAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQE
DKKCFICDSRDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFH
FTHLIMTFKTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGISTGPMKKVDDIICDS
RYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRM
EIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELC
MDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGR
NCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHV
EGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQ
CLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQCNEVESGYYFTTL
DHYIYEAEEANLGPGVIVVERQYIQDRIPSWTGPGFVRVPEGAYLEFFIDNIPYSMEYEI
LIRYEPQLPDHWEKAVITVQRPGKIPASSRCGNTVPDDDNQVVSLSPGSRYVVLPRPVCF
EKGMNYTVRLELPQYTASGSDVESPYTFIDSLVLMPYCKSLDIFTVGGSGDGEVTNSAWE
TFQRYRCLENSRSVVKTPMTDVCRNIIFSISALIHQTGLACECDPQGSLSSVCDPNGGQC
QCRPNVVGRTCNRCAPGTFGFGPNGCKPCDCHLQGSASAFCDAITGQCHCFQGIYARQCD
RCLPGYWGFPSCQPCQCNGHALDCDTVTGECLSCQDYTTGHNCERCLAGYYGDPIIGSGD
HCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGFFGNPSDFGGS
CQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGDHCQLCQYGYYGDALRQDCRKCVCNY
LGTVKEHCNGSDCHCDKATGQCSCLPNVIGQNCDRCAPNTWQLASGTGCGPCNCNAAHSF
GPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQSTGQCV
CVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDAIIGELTNRTHKFLEKAKALKISGV
IGPYRETVDSVEKKVNEIKDILAQSPAAEPLKNIGILFEEAEKLTKDVTEKMAQVEVKLT
DTASQSNSTAGELGALQAEAESLDKTVKELAEQLEFIKNSDIQGALDSITKYFQMSLEAE
KRVNASTTDPNSTVEQSALTRDRVEDLMLERESPFKEQQEEQARLLDELAGKLQSLDLSA
VAQMTCGTPPGADCSESECGGPNCRTDEGEKKCGGPGCGGLVTVAHSAWQKAMDFDRDVL
SALAEVEQLSKMVSEAKVRADEAKQNAQDVLLKTNATKEKVDKSNEDLRNLIKQIRNFLT
EDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVETLSQVEVILQQSAADIARAE
LLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIES
ETAASEETLTNASQRISKLERNVEELKRKAAQNSGEAEYIEKVVYSVKQNADDVKKTLDG
ELDEKYKKVESLIAQKTEESADARRKAELLQNEAKTLLAQANSKLQLLEDLERKYEDNQK
YLEDKAQELVRLEGEVRSLLKDISEKVAVYSTCL
Download sequence
Identical sequences E9QN70
ENSMUSP00000002979 NP_032508.2.92730 ENSMUSP00000002979 10090.ENSMUSP00000002979 ENSMUSP00000002979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]