SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_032513.3.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_032513.3.92730
Domain Number 1 Region: 216-452
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-56
Family DBL homology domain (DH-domain) 0.000044
Further Details:      
 
Domain Number 2 Region: 454-572
Classification Level Classification E-value
Superfamily PH domain-like 7.77e-32
Family Pleckstrin-homology domain (PH domain) 0.00066
Further Details:      
 
Domain Number 3 Region: 31-91
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000112
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_032513.3.92730
Sequence length 985
Comment rho guanine nucleotide exchange factor 2 isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MSRIESLTRARIDRSKEQATKTREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSI
TAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLRNNTALQSVSLRSKTTTRERP
TSAIYPSDSFRQSLLGSRRGLSSLSLAKSVSTTNIAGHFNDESPLGLRQILSQSTDSLNM
RNRTLSVESLIDEGVEVFYNELMSDFEMDEKDFEADSWSLAVDSSFLQQHKKEVMKKQDV
IYELIQTELHHVRTLKIMTRLFRTGMLEELQMEPEVVQGLFPCVDELSDIHTRFLNQLLE
RRRQALCPGSTRNFVIHRLGDLLISQFSGSNAEQMRKTYSEFCSRHTKALKLYKELYARD
KRFQQFIRKMTRSAVLKRHGVQECILLVTQRITKYPVLINRILQNSHGVEEEYQDLASAL
GLVKELLSNVDQDVHELEKEARLQEIYNRMDPRAQTPVPGKGPFGRDELLRRKLIHEGCL
LWKTATGRFKDVLLLLMTDVLVFLQEKDQKYIFTSLDKPSVVSLQNLIVRDIANQAKGMF
LISSGPPEMYEVHAASRDDRTTWIRVIQQSVRLCPSREDFPLIETEDKAYLRRIKTKLQQ
KNQALVELLQKNVELFAEMVHFQALKAGFVGMPPPALPRGLFRLESFESLRGERLLKDAL
REVEGLKDLLLGPCVDLPMTSREPALPLDSDSGSCPGVTANGEARTFNGSIELCRADSDS
SQKDRNGNQLRSPQEEVLQPLINLYGLLHGLQAVVVQQERLMEALFPEGPERWEKLSRAN
SRDGEAGRAAVASVTPEKQATELALLQRQHTLLQEELRRCQRLGEERATEAGSLEARLRE
SEQARALLEREAEEIRRQLAALGQNEPLPAEAPWARRPLDPRRRSLPAGDALYLSFNPPQ
PSRGHDRLDLPVTVRSLHRPFDDREAQELGSPEDRLQDSSDPDTGSEEEVSSRLSPPHSP
RDFTRMQDIPEETESRDGEPTASES
Download sequence
Identical sequences Q60875
10090.ENSMUSP00000029694 ENSMUSP00000029694 NP_032513.3.92730 ENSMUSP00000029694 ENSMUSP00000029694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]