SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_032543.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_032543.2.92730
Domain Number 1 Region: 214-459
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.01e-76
Family Leukotriene A4 hydrolase catalytic domain 0.00000000051
Further Details:      
 
Domain Number 2 Region: 13-208
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 1.01e-52
Family Leukotriene A4 hydrolase N-terminal domain 0.00000000702
Further Details:      
 
Domain Number 3 Region: 462-610
Classification Level Classification E-value
Superfamily ARM repeat 2.42e-46
Family Leukotriene A4 hydrolase C-terminal domain 0.000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_032543.2.92730
Sequence length 611
Comment leukotriene A-4 hydrolase isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MPEVADTCSLASPASVCRTQHLHLRCSVDFARRTLTGTAALTVQSQEENLRSLTLDTKDL
TIEKVVINGQEVKYTLGESQGYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT
PEQTSGKQHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGEAP
DPEDPSRKIYRFNQRVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSANEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFHALGGWGELQNTIKTFGES
HPFTKLVVDLKDVDPDVAYSSIPYEKGFALLFYLEQLLGGPEVFLGFLKAYVKKFSYQSV
TTDDWKSFLYSHFKDKVDLLNQVDWNTWLYAPGLPPVKPNYDVTLTNACIALSQRWVTAK
EEDLSSFSIADLKDLSSHQLNEFLAQVLQKAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVHTYQEHKASMHPVT
AMLVGRDLKVD
Download sequence
Identical sequences P24527
ENSMUSP00000016033 ENSMUSP00000016033 10090.ENSMUSP00000016033 ENSMUSP00000016033 NP_032543.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]