SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_032611.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_032611.2.92730
Domain Number 1 Region: 86-271
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.87e-50
Family Astacin 0.00025
Further Details:      
 
Domain Number 2 Region: 442-613
Classification Level Classification E-value
Superfamily TRAF domain-like 1.8e-37
Family MATH domain 0.00098
Further Details:      
 
Domain Number 3 Region: 280-443
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-30
Family MAM domain 0.0039
Further Details:      
 
Domain Number 4 Region: 686-728
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000018
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_032611.2.92730
Sequence length 760
Comment meprin A subunit alpha [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MARRLGRSSSFAIMLWIQPACLLSLIFSAHIAAVSIKHLLNGSDHDTDVGEQKDIFEINL
AAGLNLFQGDILLPRTRNAMRDPSSRWKLPIPYILADNLELNAKGAILHAFEMFRLKSCV
DFKPYEGESSYIIFQKLSGCWSMIGDQQVGQNISIGEGCDFKATIEHEILHALGFFHEQS
RTDRDDYVNIWWDQIITDYEHNFNTYDDNTITDLNTPYDYESLMHYGPFSFNKNESIPTI
TTKIPEFNTIIGQLPDFSAIDLIRLNRMYNCTATHTLLDHCDFEKTNVCGMIQGTRDDAD
WAHGDSSQPEQVDHTLVGQCKGAGYFMFFNTSLGARGEAALLESRILYPKRKQQCLQFFY
KMTGSPADRFEVWVRRDDNAGKVRQLAKIQTFQGDSDHNWKIAHVTLNEEKKFRYVFLGT
KGDPGNSSGGIYLDDITLTETPCPAGVWTIRNISQILENTVKGDKLVSPRFYNSEGYGVG
VTLYPNGRITSNSGFLGLTFHLYSGDNDAILEWPVENRQAIMTILDQEADTRNRMSLTLM
FTTSKNQTSSAINGSVIWDRPSKVGVYDKDCDCFRSLDWGWGQAISHQLLKRRNFLKGDS
LIIFVDFKDLTHLNRTEVPASARSTMPRGLLLQGQESPALGESSRKAMLEESLPSSLGQR
HPSRQKRSVENTGPMEDHNWPQYFRDPCDPNPCQNEGTCVNVKGMASCRCVSGHAFFYAG
ERCQAMHVHGSLLGLLIGCIAGLIFLTFVTFSTTNGKLRQ
Download sequence
Identical sequences A0A0R4J043
ENSMUSP00000113838 ENSMUSP00000024707 10090.ENSMUSP00000024707 NP_032611.2.92730 XP_006523814.1.92730 ENSMUSP00000024707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]