SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_032635.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_032635.1.92730
Domain Number 1 Region: 358-555
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.63e-69
Family Hemopexin-like domain 0.00001
Further Details:      
 
Domain Number 2 Region: 127-300
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.34e-52
Family Matrix metalloproteases, catalytic domain 0.000000697
Further Details:      
 
Domain Number 3 Region: 40-112
Classification Level Classification E-value
Superfamily PGBD-like 2.51e-20
Family MMP N-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_032635.1.92730
Sequence length 657
Comment matrix metalloproteinase-15 preproprotein [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MGSDRSALGRPGCTGSCLSSRASLLPLLLVLLDCLGHGTASKDAEVYAAENWLRLYGYLP
QPSRHMSTMRSAQILASALAEMQSFYGIPVTGVLDEETKTWMKRPRCGVPDQFGVHVKAN
LRRRRKRYTLTGKAWNNYHLTFSIQNYTEKLGWYNSMEAVRRAFQVWEQVTPLVFQEVSY
DDIRLRRRAEADIMVLFASGFHGDSSPFDGVGGFLAHAYFPGPGLGGDTHFDADEPWTFS
STDLHGISLFLVAVHELGHALGLEHSSNPSAIMAPFYQWMDTDNFQLPEDDLRGIQQLYG
SPDGKPQPTRPLPTVRPRRPGRPDHQPPRPPQPPHPGGKPERPPKPGPPPQPRATERPDQ
YGPNICDGNFDTVAVLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPGNISAAYE
RQDGHFVFFKGNRYWLFREANLEPGYPQPLSSYGTDIPYDRIDTAIWWEPTGHTFFFQAD
RYWRFNEETQHGDPGYPKPISVWQGIPTSPKGAFLSNDAAYTYFYKGTKYWKFNNERLRM
EPGHPKSILRDFMGCQEHVEPRSRWPDVARPPFNPNGGAEPEADGDSKEENAGDKDEGSR
VVVQMEEVVRTVNVVMVLVPLLLLLCILGLAFALVQMQRKGAPRMLLYCKRSLQEWV
Download sequence
Identical sequences O54732
NP_032635.1.92730 ENSMUSP00000034243 10090.ENSMUSP00000034243 ENSMUSP00000034243 ENSMUSP00000034243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]