SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_032671.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_032671.2.92730
Domain Number 1 Region: 960-1269
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.41e-86
Family Complement components 0.0000196
Further Details:      
 
Domain Number 2 Region: 1342-1472
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.45e-41
Family Alpha-macroglobulin receptor domain 0.00000159
Further Details:      
 
Domain Number 3 Region: 788-908
Classification Level Classification E-value
Superfamily E set domains 8.4e-26
Family SVA-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_032671.2.92730
Sequence length 1476
Comment murinoglobulin-1 precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MWKSRRAQLCLFSVLLAFLHSASLLNGDSKYMVLVPSQLYTETPEKICLHLYQLNETVTV
TASLVSQSGRKNLFDELVLDKDLFQCVSFIIPRLSSSDEEDFLYVDIKGPTHEFSKRKAV
LVKNKESVVFVQTDKPVYKPGQSVKFRVVSMDKMLRPLNELLPLAYIEDPKKNRIMQWRD
IKTENGLKQMSFSLAAEPIQGPYKIVVHKESGEKEEHSFTVMEFVLPRFNVDLKVPNAMS
VNDEVLSVTACGKYTYGKPVPGHVKINVCRETETGCREVNSQLDNNGCSTQEVNITELQS
KKRNYEVQLFHVNATVTEEGTGLEFSRSGTTKIERITNKLIFLKADSHFRHGIPFFVKVR
LVDIKGDPIPNEKVFIKAQELSYTSATTTDQHGLAEFSIDTTCISGSSLHIKVNHKEEDS
CSYFYCMEERHASAKHVAYAVYSLSKSYIYLDTETSSILPCNQIHTVQAHFILKGDLGVL
KELIFYYLVMAQGSIIQTGNHTHQVEPGEAPVKGKFALEIPVEFSMVPMAKMLIYTILPD
GEVIADSVNFEIEKCLRNKVDLRFSTSQSLPASQTRLQVTASPQSLCGLRAVDQSVLLLK
PESELSPSWIYNLPGMQQNKFVPSSRLSEDQEDCILYSSWLAEKHTNLVPHGTEKDVYRY
VEDMGLTAFTNLMIKLPIICFDYGMVPISAPRVEFDLAFTPEISWSLRTTLSKRPEEPPR
KDPSSNDPLTETIRKYFPETWVWDIVTVNSTGLAEVEMTVPDTITEWKAGALCLSNDTGL
GLSSVVPLQAFKPFFVEVSLPYSVVRGEAFMLKATVMNYLPTSMQMSVQLEASPDFTAVP
VGDDQDSYCLSANGRHTSSWLVTPKSLGNVNFSVSAEAQQSSEPCGSEVATVPETGRKDT
VVKVLIVEPEGIKQEHTFSSLFCASDAEISEKMSLVLPPTVVKDSARAHFSVMGDILSSA
IRNTQNLLHMPYGCGEQNMVLFAPNIYVLKYLNETQQLTQKIKTKALGFLRAGYQRELNY
KHKDGSYSAFGDQNGEREGNTWLTAFVLKSFAQARAFIFIDESHITHAFTWLSQKQKDNG
CFRSSGSLFNNAMKGGVDDEMTLSAYITMALLESSLPATHPVVSKALSCLESSWKTIEQE
RNASFVYTKALMAYAFALAGNQNKRDEILKSLDEEAIKENNSIHWKRPQKSRKSEHHLYK
PQASSAEVEMNAYVVLARLTAQPAPSPEDLTLSMSTIMWLTKQQNSNGGFSSTQDTVVAL
DALSKYGAVTFSRSQKTTLVTIQSTGSFSQKFQVENSNRLLLQQVALPDIPGDYTISVSG
EGCVYAQTMLRYNMHLEKQLSAFAIWVQTVPLTCNNPKGHNSFQISLEISYTGSRPASNM
VIADVKMLSGFIPLKPTVKKLERLEHVSRTEVSNNNVLIYLDQVTNQTLAFSFIIQQDIP
VRNLQPAIVKVYDYYETDEMAFAEYSSPCSTDKQNV
Download sequence
Identical sequences P28665
ENSMUSP00000032228 ENSMUSP00000032228 NP_032671.2.92730 10090.ENSMUSP00000032228 ENSMUSP00000032228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]