SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_032978.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_032978.2.92730
Domain Number 1 Region: 8-219,325-383
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.78e-46
Family FAD-linked reductases, N-terminal domain 0.0000948
Further Details:      
 
Domain Number 2 Region: 222-325
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.06e-25
Family D-aminoacid oxidase-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_032978.2.92730
Sequence length 390
Comment peroxisomal sarcosine oxidase [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MAAQTDFWDAIVIGAGIQGCFTAYHLAKHSKSVLLLEQFFLPHSRGSSHGQSRIIRKAYP
EDFYTMMMKECYQTWAQLEREAGTQLHRQTELLLLGTKENPGLKTIQATLSRQGIDHEYL
SSVDLKQRFPNIRFTRGEVGLLDKTGGVLYADKALRALQHIICQLGGTVCDGEKVVEIRP
GLPVTVKTTLKSYQANSLVITAGPWTNRLLHPLGIELPLQTLRINVCYWREKVPGSYGVS
QAFPCILGLDLAPHHIYGLPASEYPGLMKICYHHGDNVDPEERDCPKTFSDIQDVQILCH
FVRDHLPGLRAEPDIMERCMYTNTPDEHFILDCHPKYDNIVIGAGFSGHGFKLAPVVGKI
LYELSMKLPPSYDLAPFRMSRFSTLSKAHL
Download sequence
Identical sequences Q3UEJ8 Q9D826
NP_032978.2.92730 10090.ENSMUSP00000017597 ENSMUSP00000017597 ENSMUSP00000017597 ENSMUSP00000017597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]