SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_033419.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_033419.1.92730
Domain Number 1 Region: 8-159
Classification Level Classification E-value
Superfamily EF-hand 4.86e-45
Family Calmodulin-like 0.000000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_033419.1.92730
Sequence length 161
Comment troponin C, slow skeletal and cardiac muscles [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Download sequence
Identical sequences A0A0D9RLU3 A0A1U7RBF6 A0A2I3MIQ2 A0A2K5H8E2 A0A2K5MWD7 A0A2K5ZY85 A0A2K6BP78 A0A2K6MA13 A0A2K6P873 G7MV95 G7NZV9 H0WP40 P19123 Q4PP99
ENSMICP00000002573 ENSPANP00000004533 NP_001029277.1.100692 NP_001029277.1.4139 NP_033419.1.92730 XP_003495336.1.69978 XP_005085281.1.91757 XP_005348782.1.66349 XP_005547403.1.63531 XP_006981584.1.50099 XP_007623104.1.28591 XP_007982688.1.81039 XP_008850002.1.79516 XP_010363314.1.97406 XP_011737887.1.29376 XP_011814244.1.43180 XP_011841607.1.47321 XP_011914799.1.92194 XP_012626983.1.48125 XP_012660376.1.62490 XP_014986243.1.72884 XP_017717934.1.44346 XP_021059395.1.100879 XP_021490918.1.76796 ENSRNOP00000025606 ENSMUSP00000131991 ENSMUSP00000128765 ENSOGAP00000003630 10090.ENSMUSP00000022468 ENSMICP00000002573 ENSMUSP00000022468 ENSMUSP00000131991 ENSOGAP00000003630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]