SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_033912.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_033912.2.92730
Domain Number 1 Region: 476-708
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.88e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1480-1730
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-32
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number 3 Region: 1155-1317,1354-1431
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.59e-32
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number 4 Region: 89-247,289-359
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-32
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_033912.2.92730
Sequence length 2273
Comment voltage-dependent R-type calcium channel subunit alpha-1E [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MARFGEAVVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVR
QNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTP
MSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTH
FNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIG
LEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAV
LTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERE
RVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRSR
TEAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFY
WIVLSVVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSS
FNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSS
MKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDW
NEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEE
EEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWE
QRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLALG
LGLEKCEEERISRGGSLKGDIGGLTSALDNQRSPLSLGKREPPWLPRSCHGNCDPIQQEA
GGGETVVTFEDRARHRQSQRRSRHRRVRTEGKDSASASRSRSASQERSLDEGVSVEGEKE
HEPHSSHRSKEPTIHEEERTQDLRRTNSLMVPRGSGLVGALDEAETPLVQPQPELEVGKD
AALTEQEAEGSSEQALLGDVQLDVGRGISQSEPDLSCMTANMDKATTESTSVTVAIPDVD
PLVDSTVVNISNKTDGEASPLKEAETKEEEEEVEKKKKQKKEKRETGKAMVPHSSMFIFS
TTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVF
TFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSL
RVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFY
CTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQV
LQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEEC
SLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMM
KYYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEI
ILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAML
FFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKG
CEPDTTAPSGQNESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILG
PHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPV
AEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPM
PKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKA
LPYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLVVTDPSSMRRS
FSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGG
RERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSE
SSIPSISDTSTPRRSRRQLPPVPPKPRPLLSYSSLMRHTGGISPPPDGSEGGSPLASQAL
ESNSACLTESSNSLHPQQGQHPSPQHYISEPYLALHEDSHASDCGEEETLTFEAAVATSL
GRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMMCGAVSDLLSDTEEDDKC
Download sequence
Identical sequences A0A087WS83
NP_033912.2.92730 ENSMUSP00000004214 10090.ENSMUSP00000004214 ENSMUSP00000140937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]