SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_033939.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_033939.1.92730
Domain Number 1 Region: 9-256
Classification Level Classification E-value
Superfamily Caspase-like 2.24e-63
Family Caspase catalytic domain 0.0000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_033939.1.92730
Sequence length 257
Comment caspase-14 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MESEMSDPQPLQEERYDMSGARLALTLCVTKAREGSEVDMEALERMFRYLKFESTMKRDP
TAQQFLEELDEFQQTIDNWEEPVSCAFVVLMAHGEEGLLKGEDEKMVRLEDLFEVLNNKN
CKALRGKPKVYIIQACRGEHRDPGEELRGNEELGGDEELGGDEVAVLKNNPQSIPTYTDT
LHIYSTVEGYLSYRHDEKGSGFIQTLTDVFIHKKGSILELTEEITRLMANTEVMQEGKPR
KVNPEVQSTLRKKLYLQ
Download sequence
Identical sequences O89094 Q542Q1
ENSMUSP00000005488 mmt008010878.1 ENSMUSP00000005488 10090.ENSMUSP00000005488 NP_033939.1.92730 ENSMUSP00000005488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]