SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_034182.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_034182.2.92730
Domain Number 1 Region: 89-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000385
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 2 Region: 211-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family EGF-type module 0.007
Further Details:      
 
Domain Number 3 Region: 173-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 4 Region: 130-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000671
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  NP_034182.2.92730
Domain Number - Region: 57-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000511
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_034182.2.92730
Sequence length 385
Comment protein delta homolog 1 isoform 1 precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MIATGALLRVLLLLLAFGHSTYGAECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTA
PGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFS
GKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNP
CENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPP
FMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPL
LTEGQAICFTILGVLTSLVVLGTVAIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEE
LAVNIIFPEKIDMTTFNKEAGDEEI
Download sequence
Identical sequences Q925U3
10090.ENSMUSP00000063104 ENSMUSP00000063104 ENSMUSP00000063104 ENSMUSP00000105470 ENSMUSP00000139257 ENSMUSP00000139382 ENSMUSP00000139391 ENSMUSP00000063104 NP_034182.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]