SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_034214.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_034214.2.92730
Domain Number 1 Region: 182-375
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.16e-43
Family Reprolysin-like 0.00048
Further Details:      
 
Domain Number 2 Region: 396-473
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 3.42e-16
Family Blood coagulation inhibitor (disintegrin) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_034214.2.92730
Sequence length 719
Comment disintegrin and metalloproteinase domain-containing protein 18 preproprotein [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MPLLFILAELAMLFARLDSEGICLHITVPQKIEPRKGGDAEGKVTYVITIDGKPYSLHLR
NHSFLSQNFLVYTYNETGSLYSDSSHFLAHCHYRGYVDEVPNSIVTLSICSGLRGFLQLE
NVSYGIEPLESSARFEHIVYQVKSDSSMLAGNDSHVWQIDQLDKGHFNEQDKNHSQLLPQ
SLKLHIIVGKFLFDYMGSDIMAITQKIFQIIGLVNAMLTQLKLSVVLASLELWSDKNHIS
TDGNATDILQRLLDWKRDYLTLQSNEITHLLIYRRRPKYIGAASPGEICSKSYVAGVGMY
PEDIGLEGFSVVITQLIGLHIGLTYDDNIRNCSCPSAPCIMQQGALSSSGKKTFSNCSLH
DYMHYVSNFDTQCLGDLSNVHVLQPNQAVCGNGIMEAGEECDCGNETECQFKECCDHETC
RLKGSAQCGSGACCMPTCELSASGTPCRKAVDPECDFTEYCDGSSSHCVPDTFALNGHLC
RLGSAYCYNGRCQALNDQCVSLFGKGSQGASYACFEKVNSPRENLANCDSKDSYSVPCGQ
QDVLCGKLACFRPPKNYKSPSQSVVYSYVHDSVCLSILPGLSMRSDGRDSAYVADGTVCG
PQMYCINGTCKEVNFTGNDCNATKKCKGNGICNNFGNCQCFPDYRPPDCNLQIGSPGGSI
DDGNTLRTESAFATKRLSKNEDSWVILGFFIFLPFIVTFLVGIMKRNERKIVPQGEHKI
Download sequence
Identical sequences Q9R157
ENSMUSP00000033957 10090.ENSMUSP00000033957 ENSMUSP00000033957 NP_034214.2.92730 ENSMUSP00000033957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]