SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_034280.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_034280.2.92730
Domain Number 1 Region: 123-377
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.83e-64
Family Nuclear receptor ligand-binding domain 0.00000654
Further Details:      
 
Domain Number 2 Region: 55-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-30
Family Nuclear receptor 0.0000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_034280.2.92730
Sequence length 390
Comment nuclear receptor subfamily 2 group F member 6 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MAMVTGGWGDPGGDTNGVDKAGGSYPRATEDDSASPPGATSDAEPGDEERPGLQVDCVVC
GDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRV
GMRKEAVQRGRIPHALPGPAACSPPGATGVEPFTGPPVSELIAQLLRAEPYPAAGRFGGG
GAVLGIDNVCELAARLLFSTVEWARHAPFFPELPAADQVALLRLSWSELFVLNAAQAALP
LHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDAAEYGCLKAIALFTP
DACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFF
MRLVGKTPIETLIRDMLLSGSTFNWPYGSG
Download sequence
Identical sequences P43136
ENSMUSP00000002466 NP_034280.2.92730 ENSMUSP00000002466 ENSMUSP00000002466 10090.ENSMUSP00000002466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]