SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_034281.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_034281.2.92730
Domain Number 1 Region: 149-404
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.05e-70
Family Nuclear receptor ligand-binding domain 0.00000774
Further Details:      
 
Domain Number 2 Region: 81-161
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.05e-31
Family Nuclear receptor 0.0000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_034281.2.92730
Sequence length 420
Comment COUP transcription factor 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGEQQQAGSGAPHTPQTPGQPGAPAT
PGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCR
ANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHC
YLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDL
QITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQ
EQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQ
PSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQCS
Download sequence
Identical sequences F2Z3S9 Q32NY6
NP_034281.2.92730 XP_005356597.1.66349 XP_021063924.1.100879 ENSRNOP00000020044 ENSMUSP00000089036 10090.ENSMUSP00000089036 10116.ENSRNOP00000020044 ENSMUSP00000089036 ENSMUSP00000089036 ENSRNOP00000020044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]