SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_034945.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_034945.1.92730
Domain Number 1 Region: 49-138
Classification Level Classification E-value
Superfamily SH2 domain 1.94e-28
Family SH2 domain 0.00000277
Further Details:      
 
Domain Number 2 Region: 191-213,265-319
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-22
Family SH3-domain 0.0000352
Further Details:      
 
Domain Number 3 Region: 3-53
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000135
Family SH3-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_034945.1.92730
Sequence length 322
Comment GRB2-related adaptor protein 2 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIEFPEWFH
EGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTE
KFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRSQGGPHPSGTVGEEIRPS
VNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDINDGHCGL
GSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSW
WTGRLHNKLGLFPANYVAPMMR
Download sequence
Identical sequences O89100 Q3U0E8
ENSMUSP00000046532 ENSMUSP00000046532 NP_001276371.1.92730 NP_034945.1.92730 ENSMUSP00000046532 10090.ENSMUSP00000046532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]