SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_034956.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_034956.2.92730
Domain Number - Region: 535-671
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0107
Family Neurolysin-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_034956.2.92730
Sequence length 921
Comment protein MRVI1 isoform a [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MQNQRAHLWLLDPGNGTQFGTGMGRSLTCPFGISPACGAQASWSIFGVGTAEVPGTHSHS
NQAAAMPHIPEDEEPPGEPQAAQTQDSPSAGPFPSPPTIVLTGDASSPEGETDKNLVNRA
PSPHRRLSHRHLKVSTASLTSVDPSGHVIDLVNDQLPDISISEEDKKKNLALLEEAKLVS
ERFLTRRGRKSRSSLGDSPSAVSPNLSSGASPASSRSCSLTISTSPGLDICSGPQSPLPG
APPQQKGHEDGVSSPCPGEPNVSKGLADLKQNDQRKVSQGRLAPRSPTVEKTKELTVEQK
ENFDPLQHVEATPMAQASGASISGKMALNSPQPGPAEMELGRQLLKTAREGNPLPRTTAQ
GSGGTVSPHSLGQGSAGEPMGPKAGSKAELRSPVSRPPLIRGVSWDSSPEEPGPLLQKVL
AKLPLAEEEKRFPGKAKPAKPPGLKDFQIQVQPVRMQKLTKLREEHILMRNQNLVGFKLP
ELSEAAEQDKGVSPELAPAAEEEESKSGLDVMPNISDILLRKLRVHKSLTGSAPPLTEKE
VENVFVQLSLAFRNDSYTLESRINQAERERNLTEENTEKELENFKASITSSANIWYHCEH
RETYQKLLEDIAVLHRLAARLSSRAEVVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHA
ELMEFKKLANQNSSRSCGPSEDGVPRTARSMSLTMGKNMPRRRVSVAVVPKFNALNLPGQ
APSSSPMPSLPALSESSNGKSSISVSPALPALLENGKTNAEANCEVGAPVPLPSCLEETS
QETKAKAEEEAYSKGYQEGVKKTEELQDLKEEEEEEQKTESPEEPEEVEETQEDEKDQGS
SKLEELVHFLQVMYPKLCQHWQVIWMMAAVMLVLSVVLGLYSSYNSCTEEADGPPGRSTC
SAAQRDSWWSSGLQQELPAEQ
Download sequence
Identical sequences G5E8V5
NP_034956.2.92730 ENSMUSP00000114578 ENSMUSP00000117880 10090.ENSMUSP00000114578 ENSMUSP00000114578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]