SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_035234.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_035234.1.92730
Domain Number 1 Region: 405-715
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-93
Family Protein kinases, catalytic subunit 0.0000000106
Further Details:      
 
Domain Number 2 Region: 3-132
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.03e-29
Family PLC-like (P variant) 0.000000462
Further Details:      
 
Domain Number 3 Region: 236-295
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.33e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00039
Further Details:      
 
Domain Number 4 Region: 148-221
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.23e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_035234.1.92730
Sequence length 737
Comment protein kinase C epsilon type [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGKVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDEVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLAAGAESPQPASGNSPSEDDRSKSAPTSPCDQELKELE
NNIRKALSFDNRGEEHRASSATDGQLASPGENGEVRPGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGIMNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVAAQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPILTLVDEAIIKQI
NQEEFKGFSYFGEDLMP
Download sequence
Identical sequences P16054
NP_035234.1.92730 ENSMUSP00000094873 ENSMUSP00000094873 ENSMUSP00000094874 10090.ENSMUSP00000094873 ENSMUSP00000094873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]