SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_035280.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_035280.1.92730
Domain Number 1 Region: 20-125
Classification Level Classification E-value
Superfamily SRCR-like 1.05e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00000488
Further Details:      
 
Domain Number 2 Region: 131-246
Classification Level Classification E-value
Superfamily POZ domain 0.000000314
Family BTB/POZ domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_035280.1.92730
Sequence length 577
Comment galectin-3-binding protein precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MALLWLLSVFLLVPGTQGTEDGDMRLVNGASANEGRVEIFYRGRWGTVCDNLWNLLDAHV
VCRALGYENATQALGRAAFGPGKGPIMLDEVECTGTESSLASCRSLGWMVSRCGHEKDAG
VVCSNDTTGLHILDLSGELSDALGQIFDSQQGCDLFIQVTGQGYEDLSLCAHTLILRTNP
EAQALWQVVGSSVIMRVDAECMPVVRDFLRYFYSRRIEVSMSSVKCLHKLASAYGATELQ
DYCGRLFATLLPQDPTFHTPLDLYAYARATGDSMLEDLCVQFLAWNFEPLTQSESWSAVP
TTLIQALLPKSELAVSSELDLLKAVDQWSTETIASHEDIERLVEQVRFPMMLPQELFELQ
FNLSLYQDHQALFQRKTMQALEFHTVPVEVLAKYKGLNLTEDTYKPRLYTSSTWSSLVMA
STWRAQRYEYNRYNQLYTYGYGSVARYNSYQSFQTPQHPSFLFKDKQISWSATYLPTMQS
CWNYGFSCTSNELPVLGLTTSSYSNPTIGYENRVLILCGGYSVVDVTSFEGSKAPIPTAL
DTNSSKTPSLFPCASGAFSSFRVVIRPFYLTNSTDMV
Download sequence
Identical sequences Q07797
10090.ENSMUSP00000035579 NP_035280.1.92730 ENSMUSP00000035579 ENSMUSP00000035579 ENSMUSP00000035579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]