SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_035337.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_035337.2.92730
Domain Number 1 Region: 629-903
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.26e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000654
Further Details:      
 
Domain Number 2 Region: 215-360
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-35
Family Third domain of FERM 0.00019
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 8.37e-32
Family Second domain of FERM 0.00019
Further Details:      
 
Domain Number 4 Region: 508-597
Classification Level Classification E-value
Superfamily PDZ domain-like 1.26e-19
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.31e-18
Family First domain of FERM 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_035337.2.92730
Sequence length 913
Comment tyrosine-protein phosphatase non-receptor type 3 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MTSRLRALGGRINNTRTSELPKEKTRSEVICSIRFLDGLVQTFKVNKQDLGQSLLDMAYG
HLGVTEKEYFGLQHGDDPVDSPRWLEASKPLRKQLKGGFPCTLHFRVRYFIPDPNTLQQE
QTRHLYFLQLKMDVCEGRLTCPLNSAVVLASYAVQSHFGDFNSSIHHPGYLADSQFIPDQ
NDDFLSKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHNLDLMIGIASAG
IAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKS
CVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNPKKSVNNQYCKKVIGGMVWNPVMRRSLSV
ERLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGPL
SPKDSDSEVSQNHSPHRESLSENNPAQSCLTQKSSSSVSPSSNAPGSCSPDGVDQRFLED
YHKVTKGGFVEDASQYYCDKSDDGDGYLVLIRITPDEEGRFGFNLKGGVDQKMPLVVSRI
NPESPADTCMPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRKAVR
SLAEIRSEDELSQLFPEAMFPACPEGGDSLEGSMELLKKGLESGTVLIQFEQLYRKKPGL
AVSFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEMPAANLVNKYIATQGP
LPNTCAQFWQVVWDQKLSLVVMLTTLTERGRTKCHQYWPDPPDIMDHGIFHIQCQTEDCT
IAYVSREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVKYVRSLRVDGEPALV
HCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVQRLDPS
Download sequence
Identical sequences A2ALK8
NP_035337.2.92730 XP_006538161.1.92730 XP_006538162.1.92730 XP_006538163.1.92730 ENSMUSP00000075063 ENSMUSP00000075063 ENSMUSP00000075063 10090.ENSMUSP00000042412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]