SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_035656.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_035656.1.92730
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.82e-43
Family Calponin-homology domain, CH-domain 0.000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_035656.1.92730
Sequence length 201
Comment transgelin [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIVVQCGPDVGRPDRGRLGFQVWLKNGV
ILSKLVNSLYPEGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLYEG
KDMAAVQRTLMALGSLAVTKNDGNYRGDPNWFMKKAQEHKRDFTDSQLQEGKHVIGLQMG
SNRGASQAGMTGYGRPRQIIS
Download sequence
Identical sequences P37804
NP_035656.1.92730 10090.ENSMUSP00000034590 ENSMUSP00000034590 ENSMUSP00000034590 ENSMUSP00000034590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]